SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|54633781|gb|AAV36000.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|54633781|gb|AAV36000.1|
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.24e-31
Family PDI-like 0.0015
Further Details:      
 
Domain Number 2 Region: 320-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.89e-30
Family PDI-like 0.0014
Further Details:      
 
Domain Number 3 Region: 223-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.56e-17
Family PDI-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|54633781|gb|AAV36000.1|
Sequence length 482
Comment protein disulfide isomerase [Plasmodium chabaudi chabaudi]
Sequence
MNSKYFSFLLFLIPFLFQNCVRSHEDLFNEHVTSIHDGELTNFITKNDIVLVMFYAPWCG
HCKRLIPEYNDAAIMLAEKKSEIKLASVDATIERGLSQEYGITGYPTMILFNKKNRINYG
GGRTAQTIVDWILQMTGPVSTEITGNIEDVLKEKNINVAFYIEYTSEDHELFKKFNEVGD
KNREIAKYFMKKNDKHNKIYCYRKDEKTVEYDEKTPLSDFITIESFPLFGEINTENYRFY
AESPKELVWVCATIEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPG
LAYQSSEGRYVLTNPKQSLKNHKDIITFFKDVEAGKIEKSLKSEPIPEEDKDAPVKVVVG
NSFIDVVLKSGKDVLIEIYAPWCGHCKKLEPVYEELGRKLKKYDHIIVAKMDGTLNETAL
KEFEWSGFPTIFFVKAGSKIPLPYEGERSLKGFVDFLNKHSTKTPITIDGVSQSDDGASE
EL
Download sequence
Identical sequences A0A1C6YDV7 Q5UAH0
gi|54633781|gb|AAV36000.1| PCAS_093520 XP_741900.2.12432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]