SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56468393|gb|EAL46241.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56468393|gb|EAL46241.1|
Domain Number 1 Region: 262-407
Classification Level Classification E-value
Superfamily Flavoproteins 2.9e-36
Family Flavodoxin-related 0.0035
Further Details:      
 
Domain Number 2 Region: 4-292
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.52e-35
Family ROO N-terminal domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|56468393|gb|EAL46241.1|
Sequence length 413
Comment type A flavoprotein, putative [Entamoeba histolytica HM-1:IMSS]
Sequence
MTSKVLEVLPGLYWVGVMDYELKNYDVLYPAPYGSTYNSYLLQTQEGNVLFETVKQEFAN
ECLDKIEQVIGKEDCIDYIIVDHSEPDHSGSLSPILKRYPNATVIASTAALNNIQFIGHI
RDDTKTINSVKTKQLNLGDIHLKFIYQPFLHWPDTMITLIEEMNVLVTCDMFSTHFADER
MFDDLIVDRKDQYLQISYDYFNSVFGPFKRFVLKGIQTLENQPGFDLKNCKAICCSHGPI
IRGYIPERVELWRQWAQPPPLKNKVVIAYGSVYGYTETMANTIAAGIKSVGVEVSMHNVE
NTSVENVLKDFSDCKGLLLGTPTIVGDALPPILTIACNLNPYIHCQRFIQCFGSHGWSGE
GVGNLSARLQQLKAKQPVEPLSCRLQPGQEKLEECFEWGKKFGLAIKEEDEEN
Download sequence
Identical sequences A0A175JIR8 C4LX61 M2Q6D3 M3TD14 M7W2D1 N9UYT3
gi|56468393|gb|EAL46241.1| gi|67471351|ref|XP_651627.1| jCVI|EHI_159860 294381.C4LX61 XP_651627.1.49425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]