SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56473752|gb|EAL51161.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56473752|gb|EAL51161.1|
Domain Number 1 Region: 116-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.83e-91
Family Protein kinases, catalytic subunit 0.00000032
Further Details:      
 
Domain Number 2 Region: 6-98
Classification Level Classification E-value
Superfamily PH domain-like 2.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|56473752|gb|EAL51161.1|
Sequence length 433
Comment PH-protein kinase domain containing protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MEEKTQGWLMKEGGSWKSWKKRYFELNNDSLYYYKEQDKKTLMGIINLSLATHITAVDNY
HKKYENIIRICTPSRTFHLSAANEEDRLLWLTSIICHSQQSNIYKSKITTETVTQKDFDV
KCLLGKGAYGKVFLVEMISTHEIFAMKTIEKKQIIEYEEIEHTMSERRILSKLHHPFLVN
LYYSFQTPTHLFYIIDYCPGGEFYYYLQKNGKVSEEDAKFYSAQILLAIEHLHSSNIVYR
DIKPENILIGADGYLRLTDFGLSKENVTKENTTSTFCGTPEYLAPEVVVGKDYSEPVDWW
GFGILIYEMIHGHAPFTSEDIQQLFQKIIHDPVIFPNVSYPTADCKRCIQELLVKDPEKR
LTDPNRIKSHCWFKGFDWEGLFKKKLTPPFVPVLKDKTDTSNFNEDIINETAKIDEGEVV
DSKDYFNDFTYCK
Download sequence
Identical sequences A0A175JS58 C4M4G9
294381.C4M4G9 gi|56473752|gb|EAL51161.1| gi|67482395|ref|XP_656547.1| XP_656547.1.49425 jCVI|EHI_042150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]