SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56474335|gb|EAL51709.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|56474335|gb|EAL51709.1|
Domain Number 1 Region: 109-409
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-91
Family Protein kinases, catalytic subunit 0.000000198
Further Details:      
 
Domain Number 2 Region: 3-101
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-22
Family Pleckstrin-homology domain (PH domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56474335|gb|EAL51709.1|
Sequence length 434
Comment protein kinase, putative [Entamoeba histolytica HM-1:IMSS]
Sequence
MSVKTGWGIKEGGSWKTWKRRMFKLSEGKIEYFKDEGMTKKMGDIELSKVTHVLAVDQYK
KRKNLIRIITPSRTYHISVNEESDRDSWVEAIRGMIGDNKEKKTQEEKEENKISMEDFDI
ITLLGKGAFGKVMLVKYKKEGKIYAMKTVEKAQIIDSNEVEHILSEKVVLSQINNPFLVN
MHYSFQTPTHLVFILDYCAGGELFSYLQKHPAGLPEVDVKFYAAQIVLALEHMHSTGIIY
RDIKPENILFEKDGYLRMTDFGLAKSTKKGTTNTFCGTPEYLAPEVVEGLDYNEYIDWWG
LGILIYEMLFTQSPFLAETMEELYENILQREPKYPSTKPITEECMNFINSLLIKEPSKRL
TDPDQIKTHPWFNGFNFDDLYKKKLTPPYVPKIQSQTDTSNFDDEITQEEVDLKTGVEVV
ADNRFFTDFTYVQK
Download sequence
Identical sequences A0A175JQ62 C4M3C2 M2SEC0 M3TYU9 M7WHH2 N9THD7
294381.C4M3C2 EnhiA.00764.a gi|56474335|gb|EAL51709.1| gi|67483754|ref|XP_657097.1| XP_657097.1.49425 jCVI|EHI_053040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]