SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|56512914|emb|CAH78623.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|56512914|emb|CAH78623.1|
Domain Number - Region: 107-150
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00419
Family NusA extra C-terminal domains 0.046
Further Details:      
 
Domain Number - Region: 43-98
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 0.00824
Family eIF2alpha middle domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|56512914|emb|CAH78623.1|
Sequence length 191
Comment conserved hypothetical protein [Plasmodium chabaudi chabaudi]
Sequence
MPKILSESHEIISNKSDIQLKTEDESSSNRKGSLVSNKMVSKDAYNNRSRVQQLLSRIAQ
EIDENKPNDVIHFIVDFLCKHYPEHLHGFEAVWNGDPDLEKERILVVEFFKYQKLPADIS
VHFINAGFDTIETLCTLSTNSLDDVEKFNNTRWLPGHKVRLQQTFNDITTRVKNFKEERD
SLIKSMNQRFI
Download sequence
Identical sequences Q4XWT8
gi|56512914|emb|CAH78623.1| gi|70931670|ref|XP_737484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]