SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66358406|ref|XP_626381.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66358406|ref|XP_626381.1|
Domain Number 1 Region: 344-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.41e-27
Family Pan module (APPLE domain) 0.0058
Further Details:      
 
Domain Number 2 Region: 76-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000102
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 3 Region: 36-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000392
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 181-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000057
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 213-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000737
Family EGF-type module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66358406|ref|XP_626381.1|
Sequence length 614
Comment extracellular protein with signal peptide, 5xEGF and apple domains [Cryptosporidium parvum Iowa II]
Sequence
MNLYNNPLLEVRIPRVVIITFVFIIWIRRTNQQVINACTIGNNPCTENAECYVETLFIGA
PKCRCPNGFQGDGLIGGTGCQDIDECTMGIHTCEPKTQRCINTIGSYECECLSGFRKHEQ
RLNVCVDIDECMELSVCPSSTLCINTEGSFKCECLDRELIFDQGRCRPINKCTDFNGRLN
DCSQNCVMGSDGRGKCECNPGFKLHEDRKTCVDINECEENNPCDLSISSCINTPGSYICD
CFKSAGYMTSPINNKICININECEEDPMICGDLNMCCKDLAPPDKYECVFPSINSEVINR
IDVNNHSKEGMKNVEGEHKNLENNSKYIQNNKISRKWIETNKEYGNNADSIESNNNSGCY
DSDIEYPGYTIQILHSLTSAFDCQLQCQVDLGCDFFTYDMMNRVCLFKAAKSEPKESPGM
ISGPKYCSYKKINKNKLFPLDSASSQSSLLRRMSSNNNSNKSNQISDNKCPPGFNFAYDI
WRKQKNKKTMEVIQKQFGTKQMNSINPVDISEGLQSNTNFMANQINQWYDVFSNVPTTFS
NTTKQTNKPVPKLESSNINPGFIAGGIPPPPRGTNFPYNEHYKFNQYQDQNSQIPHKYGH
NTPIYGMKSDNSIT
Download sequence
Identical sequences Q5CTT8
XP_626381.1.25317 5807.cgd2_1590 gb|cgd2_1590 gi|46227894|gb|EAK88814.1| gi|66358406|ref|XP_626381.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]