SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|66363374|ref|XP_628653.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|66363374|ref|XP_628653.1|
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.69e-24
Family PDI-like 0.013
Further Details:      
 
Domain Number 2 Region: 355-479
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000016
Family PDI-like 0.041
Further Details:      
 
Domain Number 3 Region: 257-389
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000197
Family PDI-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|66363374|ref|XP_628653.1|
Sequence length 556
Comment protein disulfide isomerase, signal peptide plus ER retention motif [Cryptosporidium parvum Iowa II]
Sequence
MKISWRILLTLQTVLFFLYFSIVKGGNLTELNKDSFQEFITKNEHCLVIFYTDDCAACVT
IIERLEKLNEEIGNIKVNVAKINGERNIKILEEYQINDYPTMKFFRNKVAEEYYGGREEN
EILEWLKEQVAFPVLELEKNMINKEKLENLLLKNDVLYIFYGDKNGIERSIFNDVANYNR
ASGKFYQISKDDLGFGLSKESFINVFQSGIELDSIKNDLKKNSFDPWIVCLRRYENAIPF
HGSSKQRKEVWDFVKANQIPLFGEISSRNYVKYSEVEYDLIWLLVPMEPGKGEESIKPYV
ALFTQISQEFADNYRVVWLDTSEHSSHLNTVLLVEPEMLPTVAVAKSRPYLLPPNTPIEY
LTIKKFLQDIELNKVEPKLRSEPIPVYYDNDTVFKLVGSNFNSMVLEDKKNDWLVVLVTP
FCQPCIDTEEIIRKLHDAISFGNSESKIKFGSFDISENDLPKDEFYSSSIPSIIFFNRKD
SGNPIHFNAEEISYINIKDYMMNSTSIDSNEISFIDPANATDLVVTIFSDFEQFSDEFPT
QEQIEAVEKSIKHDEL
Download sequence
Identical sequences Q5CXS7
gi|46229649|gb|EAK90467.1| gi|66363374|ref|XP_628653.1| 5807.cgd7_5100 gb|cgd7_5100 XP_628653.1.25317 NYSGRC-SEC-cgd7_5100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]