SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67471806|ref|XP_651815.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67471806|ref|XP_651815.1|
Domain Number 1 Region: 261-404
Classification Level Classification E-value
Superfamily Flavoproteins 1.97e-37
Family Flavodoxin-related 0.0052
Further Details:      
 
Domain Number 2 Region: 12-297
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 4.47e-37
Family ROO N-terminal domain-like 0.0000698
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67471806|ref|XP_651815.1|
Sequence length 411
Comment type A flavoprotein [Entamoeba histolytica HM-1:IMSS]
Sequence
MQNLAVKVVDNLYWVGVFDFDLRTFDVIVPTPFGTTYNSFLLTTNDGNVLFETVKEPFYQ
EHLERIENVIGKKGQINYIILNHTEPDHSGSLNHILEKYPNATIIATVAALNNLKFISHL
SPEVKTVCSIKLKSLQVGEYHLKFLIQPFLHWPDTMMTVIEELKILLPCDFFAVHYAEPK
LFDDQIEGKEHIFEKLYRHYFDAVMSPFKSSVLKGVQLVETQMGFPVEELQVICCSHGLI
IRKDIKKIIEKYKEWSQPQMLKNKVIVVYGSAYGYTKIMTNKIVEGIKSTGVEVIVYNIV
NTTITEILKDFKDAKGLLLGSPTIVGDATPPFYDLLGHLNPFMHNNRLIQCFGSFGWSGE
GVKNLIPRIQQLKVKEVNKPLSIRFRPTKEQEIECFNWGKDFGSKVIDHNH
Download sequence
Identical sequences A0A175JTM8 C4M5R3 M2S4U2 M3TCL7 M7WW20 N9TJ57
XP_651815.1.49425 jCVI|EHI_129890 gi|56468595|gb|EAL46428.1| gi|67471806|ref|XP_651815.1| EnhiA.01542.a 294381.C4M5R3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]