SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67482702|ref|XP_656668.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67482702|ref|XP_656668.1|
Domain Number 1 Region: 116-408
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-92
Family Protein kinases, catalytic subunit 0.000000275
Further Details:      
 
Domain Number 2 Region: 6-100
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-27
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|67482702|ref|XP_656668.1|
Sequence length 433
Comment PH-protein kinase domain containing protein [Entamoeba histolytica HM-1:IMSS]
Sequence
MEEKTQGWLMKEGGSWKSWKKRYFVLDNDTLYYYKEQDKKTLMGTMNLSLATHITAVDNY
HKKYENIIRICTPSRTFHLSAANEEERLAWLTSIICHSEKTNICKPRISSVPVTQKDFDV
KCLLGKGAYGKVFLVEMISTHEIFAMKTIEKKQIIEYEEIEHTMSERRILSKLHHPFLVN
LYYSFQTPTHLFYIIDYCPGGEFYYYLQKNGKVSEEDAKFYAAQILLAIEHLHSSNIVYR
DIKPENILIGADGYLRLTDFGLSKENVTKENTTSTFCGTPEYLAPEVVVGKDYSEPVDWW
GFGILIYEMIHGHAPFTSEDIQQLFQKIIHDPVSFPSASYPSADCKECIVMLLEKDPEKR
LTDPNRIKSHCWFKGFDWEGLFQKKLSPPFVPVLKDKTDTSNFNEDIINETAKIDEGEVV
DSKDYFNDFTYCK
Download sequence
Identical sequences A0A175JPI5 C4M2W0
294381.C4M2W0 XP_656668.1.49425 jCVI|EHI_188930 gi|56473883|gb|EAL51282.1| gi|67482702|ref|XP_656668.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]