SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67596942|ref|XP_666110.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67596942|ref|XP_666110.1|
Domain Number 1 Region: 20-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.27e-24
Family PDI-like 0.011
Further Details:      
 
Domain Number 2 Region: 355-479
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000225
Family PDI-like 0.037
Further Details:      
 
Domain Number 3 Region: 257-389
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000194
Family PDI-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67596942|ref|XP_666110.1|
Sequence length 556
Comment protein disulfide isomerase precursor (PDI) [Cryptosporidium hominis TU502]
Sequence
MEMSWRILLTLQTVLFFLYFSIVKGGNLTELNKDSFQDFITKNEHCLVIFYTDDCAACVT
IIERLEKLNEEIRNIKVNVAKINGERNIKILEEYQINDYPTMKFFRNKVAEEYYGGREEN
EILEWLKEQVAFPVLELEKNMINKEKLENLLLKNDVLYIFYGDKNGMERSIFNDVANYNR
ASGKFYQISKDDLGFGLSKESFINVFQSGIELDSIKNDLKKSSFDPWIVCLRRYENAIPF
HGSSKQRKEVWDFVKANQIPLFGEISSRNYVKYSEVEYDLIWLLVPMEPGKGEESIKPYV
ALFTQISQEFADNYRVVWLDTSEHSSHLNTVLLVEPEMLPTVAVAKSRPYLLPPNTPIEY
LTIKKFLQDIELNKVEPKLRSEPIPVYYDNDTVFKLVGSNFNSMVLEDKKNDWLVILVTP
FCQPCIDTEEIIRKLHDAISFGNSESKIKFGSFDISENDLPKDEFYSNSIPSIIFFNRKD
SGNPIHFNAEEISYINIKDYMMNSTSIDSNEISFIDPANATDLVVTIFSDFEQFSDEFPT
QEQIETVEKSIKHDEL
Download sequence
Identical sequences A0A0S4TK36
XP_666110.1.74355 237895.Q5CGZ8 Chro.70569 gi|67596942|ref|XP_666110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]