SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67608856|ref|XP_666910.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67608856|ref|XP_666910.1|
Domain Number 1 Region: 23-73
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000085
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 2 Region: 72-126
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 3 Region: 132-173
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000114
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67608856|ref|XP_666910.1|
Sequence length 204
Comment sporozoite cysteine-rich protein [Cryptosporidium hominis TU502]
Sequence
MAGGLECTITSQISACNSDVECLPCGFTDWGSWSPCSASCDGGFTIRTRELTHSAPGCDS
LLKEKSSCNSSPCPVDCVLSFWSPWTDCSKFLCEGTKSRYRVVVREAMNGGTACPSSNQL
RQVVECSGCEGICDTQIEPICQNSGECFNIGNDGYYCKCAEGFYGRNCTISSDNKFNIIL
GTSSGLAVGLLVVLFILLLSRSRN
Download sequence
Identical sequences Chro.60101 gi|67608856|ref|XP_666910.1| 237895.Q5CJ96 XP_666910.1.74355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]