SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|67616232|ref|XP_667468.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|67616232|ref|XP_667468.1|
Domain Number 1 Region: 344-431
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.77e-27
Family Pan module (APPLE domain) 0.0058
Further Details:      
 
Domain Number 2 Region: 76-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000559
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 3 Region: 37-172
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000235
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 181-222
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000516
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  gi|67616232|ref|XP_667468.1|
Domain Number - Region: 227-270
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000963
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|67616232|ref|XP_667468.1|
Sequence length 614
Comment fibrillin 2; syndatyly ems [Cryptosporidium hominis TU502]
Sequence
MNLYNNPLLEVRIPRVVIITFVFIIWIRRTNQQVINACTIGNNPCTENAECYVETLFIGA
PKCRCPNGFQGDGLIGGTGCQDIDECAMGIHTCEPKTQRCINTIGSYECECLSGFRKHEQ
RLNVCVDIDECMELSVCPSSTLCINTEGSFKCECLDRELIFDQGRCRPINKCTDFNGRLN
DCSQNCVLGSDGRGKCECNPGFKLHEDRKTCVDINECEENNPCDLSISSCINIPGSYICD
CFKSAGYMTSPINNKICININECEEDPMICGDLNMCCKDLAPPDKYECVFPSINSEVINR
IDVNNHLKEGMKNVEGEHKNLENNSKYIQNNKISRKWIETNKEYGNNADSIASNNNSGCY
DSDIEYPGYTIQILHSLTSAFDCQLQCQVDLGCDFFTYDMMNRVCLFKAAKSEPKESPGM
ISGPKYCNYKKISKNKLFPLDSASSQSSLLRRMSSNNNSNKPNQISDNKCPPGFNFAYDI
WRKQKNKRTMEVIQKQFGTKQMNSINPVDISEGLQSNTNFMANQINQWYDVFSNVPTTFS
NTTKQTNKSVPKLESSNINPGFIAGGIPPPPRGTNFPYNEHYKFNQYQDQNSQIPHKHGH
NTPIYGMKSDNSIT
Download sequence
Identical sequences 237895.Q5CKU6 Chro.20173 XP_667468.1.74355 gi|67616232|ref|XP_667468.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]