SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68066717|ref|XP_675332.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68066717|ref|XP_675332.1|
Domain Number 1 Region: 55-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000612
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68066717|ref|XP_675332.1|
Sequence length 194
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MKISILVLFLIFIKNIICEIRELSFHEFERMLTKNYHQNKNYILENKINYKKSHTIKDYL
YLNTDNDFVLYLYAKWNADSNNLITVFREVARIIEEKNLKIPFYTFNVDNAKEFCNLINV
TSLPLILYVSSVHKKKYDSLLQKIVNSSKDIKIGNAFRYSGDMYCYDYIVDWVEVHHYFA
KALLFMKRIFMKRI
Download sequence
Identical sequences A0A077XEH4 A0A0Y9YE82 Q4YNK5
XP_675332.1.11252 gi|68066717|ref|XP_675332.1| PBANKA_121210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]