SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68069067|ref|XP_676444.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68069067|ref|XP_676444.1|
Domain Number 1 Region: 43-178
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-16
Family Glutathione peroxidase-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68069067|ref|XP_676444.1|
Sequence length 206
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MSCANFNSPYQAEKRRTAENADNQNLESIKKPIDYSDMDLILFPEGSLKNINNTVVNEKH
LVGKSVALFFSNGSDPKCRAFLPFLQQYYKTINEAGSSQKIEIIFVSVDTDRASFEDHKK
HMPWLYIDVADPLTDILKKHFRVMNAYEVPFYGSGPRSDVPCLVVIGSDGREAQLLHVCS
GREEGEKGVLRWDFRNNIYSLNKKGL
Download sequence
Identical sequences A0A077X9T9 A0A0Y9W4W6 Q4YQP4
XP_676444.1.11252 PBANKA_082020 gi|68069067|ref|XP_676444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]