SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68070467|ref|XP_677145.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68070467|ref|XP_677145.1|
Domain Number 1 Region: 25-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.58e-32
Family PDI-like 0.0013
Further Details:      
 
Domain Number 2 Region: 319-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.74e-30
Family PDI-like 0.0013
Further Details:      
 
Domain Number 3 Region: 223-351
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.6e-18
Family PDI-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|68070467|ref|XP_677145.1|
Sequence length 482
Comment disulfide isomerase precursor [Plasmodium berghei strain ANKA]
Sequence
MNTKYISFFLFIIPFIFKNYVRSHEDLFNEHITSIHDGELNNFITKNDIVLVMFYAPWCG
HCKRLIPEYNEAAIMLSEKKSEIKLASVDATVERGLSQEYGITGYPTMILFNKKNRINYG
GGRTAQTIVDWILQMTGPVSTEITGNIEDVLKESNINVAFYMEYISEDNELFKKFNEVGD
KNREIAKYFIKKNDKHNKIYCYRKDEKTVEYDEKTPLNDFVAIESFPLFGEINTENYRFY
AESPKELVWICATIEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKASLGINEFPG
LAYQSSEGRYLLANPQQSLKNHKDIISFFKDVEAGKIEKSLKSEPIPEEDKNAAVKVVVG
NSFTDVVLNSGKDVLIEIYAPWCGHCKKLEPIYEELGRKLKKYDHIIVAKMDGTLNETSL
KEFEWSGFPTIFFVKAGSKIPLPYEGERTLKGFVDFLNKHSTKTPITIDDVSQSYEGSSE
EL
Download sequence
Identical sequences A0A077XA75 Q2XQR4 Q4Z2V7
XP_677145.1.11252 gi|68070467|ref|XP_677145.1| PBANKA_070280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]