SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68071965|ref|XP_677896.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|68071965|ref|XP_677896.1|
Domain Number - Region: 58-96,126-151
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000633
Family Glutathione S-transferase (GST), N-terminal domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68071965|ref|XP_677896.1|
Sequence length 162
Comment hypothetical protein [Plasmodium berghei strain ANKA]
Sequence
MRKIIFLIVIVLSFLGLIQNKGRTPNRNSKIKKLPVIKDSTKLISIIDKTPTKQYITYVY
HSSICSYCSLITDALKDNEHVKMIKINDDSKLEDLIKTDKPIVVILKNINKEDSVERSKF
YYELQKKGGKVRVPALEINNHIMYESKEILAFYKHLLSKFEN
Download sequence
Identical sequences Q4YAW0
PBANKA_136450 gi|68071965|ref|XP_677896.1| XP_677896.1.11252

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]