SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68073181|ref|XP_678505.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68073181|ref|XP_678505.1|
Domain Number 1 Region: 1488-1537
Classification Level Classification E-value
Superfamily EGF/Laminin 7.53e-17
Family Merozoite surface protein 1 (MSP-1) 0.0028
Further Details:      
 
Domain Number 2 Region: 1444-1486
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000000165
Family Merozoite surface protein 1 (MSP-1) 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|68073181|ref|XP_678505.1|
Sequence length 1556
Comment merozoite surface protein 1, precursor [Plasmodium berghei strain ANKA]
Sequence
KLQGFITKFEELGFTEQTELVNLIKTLVPNKYGLKYLIESKEEFNGLMHAINFYYDVFRD
KLNDMCANNYCEIPEHLKISEEETEMLKKVILGYRKPIENIQDDIEKLEIYITKNKETVT
ALNTLIAEETKKITPENEADCNDNTCDESKYSKKKIIYQAMYNVIFYKKQLAEIQKVIET
LEKRVSALKKNDVIKPLLQQIEDIKAAPVTTEGQITTSGQSKKKKKMDGLYAQIKEIAKT
IKFNLDGIFVNPIELEYFKKEKKKESCNLSTSSCKKNKTSETIIPLNVRYPNGIGYPLPE
NDVYNKIANNAAETTYGDLTNPDNTPITEDLATNEQARKNLIKAIKKKIEAEEKNLESLK
TNYDNKLASFNQQKAPFKEAAKLFYESKFGNKLTSDIFEKFKTQRTEYMNKKTELENCLY
GNTKQLISKLNKQLNYLQDYSLRKDIISEIEYFSNKKKGLQYNINRLAEAVQAKQNILVA
SKDVPLSTLVELQIQKSLLTKQIEQLNKTELSLRKAQLKDKVYVPKSYGNGGKPEPYYLI
AVKREVDRLAQFIPKIENMIAKEKEKTEQVPVVTGESEETSSVTGATSPTVTPVTEEAQS
SQNAPPTTAATPATTPEAATTAATPATTPEAATTSTTTSTTTSTTTSTTTPVMTKLYYLE
KLQKFLVFSYSCHKYLLLQNSTINKDALSKYALTTEEDKIRTLKRCSELDILLAIQNNMP
TMYSLYESIVDGLQNIYAELYEKEMMYHIYKLKDENPSIKSILQQQHLIQAQTPASNPGA
SASSTPSTPAAASNPGASASSTPSTASNPSAPASSTVQPTQVQPAAPAAPAAVPAQPANS
NGSITTRAESEEDIPADDFELDNLYKSYLQRIDGNNTEFINFIKSKKELIKALTPEKVNQ
LYLEIAHLKELSEHYYDRYYKYKLKLERLYEKHEQIQVSNRQIRELSILKARLLKRKQNI
NGIFYILSGYVNFFNKRREADKQYVDNALKNNDMLLKYYKARIKYFTSEAVPLKTLTKAS
LDRETNYLKIEKFRAYSRLELRFKKNINLGKEKISYVSGGLYHVFEEFKELLKNKNYTGK
TNPDTVPEVTNAFEQYKELLPKGVTASASPAAATTPTSADAATQRATPESRSGSGSGSGS
VVSSTPEEVARSGSGENAVVSGSSVDDNDDDDIDQIASGQSENAQEKNILEAFKNESEYL
YARSLGITYKSLKKHMIREFSTIKEDMTTGLNNKLQKRNDFLEVLNHELDLFKDLSTNKY
VIRNPYQLLDNDKKDKQIVNLKYAAKGVNEDIETTADGIKFFNKMIELYKIQLAAVKEQI
DAIEAATTDKDEKKKYVPIFEDLKGLYETILGQSEEYIEVLQNRLDSYKNEKTEFEILTK
NLETYIKIDEKLENFVENAENNKHIASIALNNLNKSGLVGEGESKKILAKMLNMDSMDLL
GIDPKHVCINTRDIPANAGCFRYDNGNEEWRCLLGYKKNNNTCIEDSNPTCGNNNGGCDP
TAGCQTAENRENSKKIICTCKEPTPNAYYDGVFCSSSSFMGLSILLIITLIVFNIF
Download sequence
Identical sequences Q4Z273
XP_678505.1.11252 gi|68073181|ref|XP_678505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]