SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|68129117|emb|CAJ06790.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|68129117|emb|CAJ06790.1|
Domain Number 1 Region: 419-472
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000737
Family Transcriptional factor domain 0.0022
Further Details:      
 
Domain Number 2 Region: 163-242
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000157
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0049
Further Details:      
 
Domain Number 3 Region: 3-46
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.000000391
Family PWWP domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|68129117|emb|CAJ06790.1|
Sequence length 473
Comment transcription elongation factor-like protein [Leishmania major strain Friedlin]
Sequence
MATYVPGDRVWVYIEGDGWWPACVLSDEEMGTRTPGFDLAVQFYAGVEQPATLYELNSHA
DAANICFFETSSEKAVTGNPELEAAIRCACAHAEANPLKSASAIVGGARVAAGGSGAAGS
SGAAVVDRAASKRVRDMGDDDTGVYSSGAAASRSVSGYHHLRSDKLHELSSKISSAVAAA
DLTAVRAALCQLDGVDVYLTELEDTKIGVAVGSVLSQPVLKPLWPLARAMISFWARHLPA
ETLAAIRSVQQRQLPVPATSAAAAAEPPSPLSKQQPAFPAVPSGSAFASSVSPSAATAAG
GAGAGAAGGAGSGDVAPTQRKTFYDNVYQLLDSPLSTTRYDDTVIDEVARRLTAEITDRD
ERQMLLLRLREEELSFIRDHLLSGEWTPKKYLDQPSEVFTTKSEKARQEQRIQEKMKAIE
AADNAMLNITSLFKCGRCGKRHCTFYEQQTRSADEPTTKYITCLDCKNTWTQE
Download sequence
Identical sequences Q4Q3Q4
gi|157875290|ref|XP_001686044.1| gi|68129117|emb|CAJ06790.1| XP_001686044.1.98313 psu|LmjF33.2810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]