SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71393635|ref|XP_802231.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71393635|ref|XP_802231.1|
Domain Number 1 Region: 31-121
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000000034
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0057
Further Details:      
 
Domain Number 2 Region: 254-303
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000259
Family Transcriptional factor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71393635|ref|XP_802231.1|
Sequence length 306
Comment hypothetical protein [Trypanosoma cruzi strain CL Brener]
Sequence
EEAGFLPTHQEDDAAYLERMLRENRHTVSDSTLATIRHKLETLTEACNHGGVISVSEAAE
EELLEVLSPLSLVNVTLDQLRRLKIGVTVGKFLLRDYPVRVVSLASAILTYWFRQLPPAT
QQLLSKKSALDMASNDTTIGSERQDVSLGALGVQLEACFTDEEVCDTINDPVIVAGNIEK
ELEAVDDEDVSMEVLAALRDGSNTALRCGLLDGSITAKDFVANPTNPDLLLKRSDNDGDK
PSGVSPVEPESPLEEGSDLTNFTTLYVCPGCGAREAVANEYSVQAHDNMAVFVRCLKCDE
TWNVEA
Download sequence
Identical sequences Q4CKI3
gi|71393635|ref|XP_802231.1| XP_802231.1.87722 psu|Tc00.1047053480653.10

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]