SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71408730|ref|XP_806751.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|71408730|ref|XP_806751.1|
Domain Number 1 Region: 434-843
Classification Level Classification E-value
Superfamily RNI-like 4.12e-50
Family 28-residue LRR 0.0042
Further Details:      
 
Domain Number 2 Region: 91-196
Classification Level Classification E-value
Superfamily Second domain of FERM 1.96e-19
Family Second domain of FERM 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|71408730|ref|XP_806751.1|
Domain Number - Region: 202-285
Classification Level Classification E-value
Superfamily PH domain-like 0.0194
Family Third domain of FERM 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|71408730|ref|XP_806751.1|
Sequence length 870
Comment ribonuclease inhibitor [Trypanosoma cruzi strain CL Brener]
Sequence
EAALTYTVQFVDGTKRRVDAFPSDTVAVMISRVALRAGIVQWRMFYLAELADEGTVLGLV
HRYLSRSATLEDEGVTPQTALLFEFKHYKRPLHWDDAVAQELFFRQLQQHIVREYYPVSE
AVAVQLASYELQAVFGDFTAQKSLLYFDRVGLEAYLPISVSAHEYDYWQQRLATNHRRRA
GLTATQARCGYIDVVSTTPWWGMTFFDVRDRDNCPFIAGVAEDGFYVFSASKQECLDAIP
FPDLVGWERCPAGVVIRRRGTHTMTLYATSQLQAKELVDLLSEYYMLLPQRVRDGMRIDV
GDLETVSAGLVSPTVFEFPVVSRPHPAPYESRVECMKAAYMSYCAEVDELGQQHVPAAAL
LRAMDRAVDDGTALDALDLAMADPPVDDRHFAVLAEILTFTLREYEPPEKHEGWKENIAV
TAVLLAQASVERQLLTASSVPTIAKVIALFPALQTLDLSYIPLDTTSEQLGGALARGAKQ
LRRLVLRGCRVGARALQSILVIFGSQKPNALEHLDLEDNFLTHAAIHPLCEVLMDGRAAL
TELNLAFNRLEPSGIDAIAKALRASPQLQSLDVSGNPGVEPPSMRAPLLVTKGSGIARLS
LRSCKLHFALFGAMNAELISNGDIVELNLSANPIGDGVDTRAAMAAFSFLGDPRSACRLE
VFCMEDCGLMEGVLGDALGGAMASNRTVQRLFLRSNGLARKTGFLPPLLTEAVGTHSVLC
VLDLSDNGISHAGCMRLFAALVRSNSMCKLYLDGNHLGAAEEPASYAELVALLENSVSLS
VLSLCNTEMQDAALEKVGEGLSRNTALHTFVASGNAFTASGIAAFARLIHHNVTLKNLDL
STEALCHDEAVYADTHRLLSGVGRLDSVQL
Download sequence
Identical sequences Q4CX93
XP_806751.1.87722 gi|71408730|ref|XP_806751.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]