SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|71748352|ref|XP_823231.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|71748352|ref|XP_823231.1|
Domain Number - Region: 227-346
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0146
Family Calponin-homology domain, CH-domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|71748352|ref|XP_823231.1|
Sequence length 822
Comment hypothetical protein [Trypanosoma brucei TREU927]
Sequence
MNSSGLVLELLCNLRWVLSYIVQRLDPIVEKHYGRTIEQAKRMESAVSRSFANAQSLSDL
PPEVLTLAQEGVVYLLVAEGVLGYCPPTMHSFLLRGASSCVSEAFSGCFSGNSSASSACS
KIHSTASNYQAQFLVVRWLTEEGILTDEELLDAMDEGGEVPLNKQESRFGLHMAMAERLS
VECSFSVQAHVVLTRSLLLYYCSTLITVEDVELHLNFLDPTCEKELTNMESALLLWLLCL
LKNMQRGGTINDQVFRELKGSADSLYKTVQSGTVLALVMSFYKPHLLPPSSIDARASNPS
EMLRQQQHFEHWGKTLRVAEELGLSPCLYADEAGQYGSVVLQLHVLRFIGELFAMLATQA
EDVEGFCAYAVRSQKLHASADCQRWCSMMGSDRSGGHADGSMNVNGMESSCETFRDAELS
QRKGDNEDSAVDHTRSINSSVVYSCFPSAHNRRQYDVMKASLLRSGENDMAAPKYCSSSG
KHCEARNVSSVEGHVDLGVEESFASEGLVPSASGAHRSPTAAPSYAGLVDSCRTRTRTSV
AKVWWSSDEGDVEVFSHSTSGTGNDVFLNSTIVQAPSLPSSGCANSSVCMQQRGWKPRDS
SLHPPAPFNIEESDGSGASPRFGHSDMLSPLSSTACEAEVVVGIDGSRITSENSFRINTV
ERGYTPQASSSGLSPLTPVETTDRGTIPVDMAIQKNNDAKNGTFPRAPHSGAREQMQNCP
PNDESDDDALLREVYSLYPALPTIDSRQKLLETLEHQHVLIKRLTQKLLEAKKASPSPAG
LAPPEVADPNRTLPSIMNKAKERFHHESAAGRMGNEKMNSEK
Download sequence
Identical sequences Q389W7
gi|71748352|ref|XP_823231.1| 5691.Tb10.6k15.0180 Tb927.10.10100 XP_823231.1.54365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]