SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82540329|ref|XP_724491.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82540329|ref|XP_724491.1|
Domain Number 1 Region: 379-417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000753
Family Merozoite surface protein 1 (MSP-1) 0.026
Further Details:      
 
Domain Number 2 Region: 330-364
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000573
Family Merozoite surface protein 1 (MSP-1) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|82540329|ref|XP_724491.1|
Sequence length 441
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MILAKRNKLFTLSFLLIVYANNATLSSVNDKNNNINVTPTSQENNEEDVIEEIEDDHINI
DDHIIITDEEDGINNIKETYFIRKENYNNKPQNNPIEDLKEQQNSDNVKIDVFNFTDNEK
ETIKNFQEDMESNKMNINNEDDSFLGKLIRIIPNIANFGKIKDSNSDQSENQSDDISDVN
KTVEGEDDDTVHVNIDTNQEKGDNENTDEQSEISTEPSNDINTQNEQTNDTNDVKDEEED
ISVSNGITTLSLKNNETSNTTIENNPEKKKENKEDIIDHADIMRITLLAENRNLKETTRI
LDEAVYKIERFVLKCKFYITAITNFVKFKTNHICEYSKCGDNARCYIIEKDRQECRCLAN
YVRDTSVEYFKCVPMPIKDCNNNNGNCDKNAECSIKNNKIICHCSYDYFGDGIFCVPNSH
YNNFLHISLIIIGCIVQKFLF
Download sequence
Identical sequences A0A078KC55 Q7RGX0
1271.m00082|PY04226|PY04226|hypothetical 73239.Q7RGX0 XP_724491.1.76580 gi|82540329|ref|XP_724491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]