SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82595601|ref|XP_725916.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82595601|ref|XP_725916.1|
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.22e-32
Family PDI-like 0.0016
Further Details:      
 
Domain Number 2 Region: 329-471
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.52e-30
Family PDI-like 0.0013
Further Details:      
 
Domain Number 3 Region: 232-360
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.05e-17
Family PDI-like 0.0016
Further Details:      
 
Weak hits

Sequence:  gi|82595601|ref|XP_725916.1|
Domain Number - Region: 157-245
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0224
Family PDI-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|82595601|ref|XP_725916.1|
Sequence length 491
Comment protein disulfide isomerase [Plasmodium yoelii yoelii str. 17XNL]
Sequence
GVYLNKAPKMNTKYISFLLFLIPFVFKNYVRSHEDLFNEHITSIHDGELSNFITKNDIVL
VMFYAPWCGHCKRLIPEYNEAAIMLSEKKSEIKLASVDATIERGLSQEYGITGYPTMILF
NKKNRINYGGGRTAQTIVDWILQMTGPVSTEITGNIEDVLKEKNINVAFYMEYTSEDNEL
FKMFNEVGDKNREIAKYFMKKNDKHNKIYCYRKDEKTVEYDEKTPLNDFVSIESFPLFGE
INTENYRFYAESPKELVWVCATVEQYNEIKEEVRLAAAELRNKTHFVLLNIPEYADHAKA
SLGINEFPGLAYQSSEGRYLLTNPQQSLKNHKDIISFFKDVEAGKIEKSLKSEPIPEEDK
NAAVKVVVGNSFIDVVLNSGKDVLIEIYAPWCGHCKKLEPVYEELGRKLKKYDHIIVAKM
DGTLNETALKEFEWSGFPTIFFVKAGSKIPLPYEGERTLKGFVDFLNKHSTKTPITIDGV
SQSDEGSSEEL
Download sequence
Identical sequences Q7RRT0
174.m00035|PY00638|PY00638|protein gi|82595601|ref|XP_725916.1| 73239.Q7RRT0 XP_725916.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]