SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82596427|ref|XP_726257.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82596427|ref|XP_726257.1|
Domain Number 1 Region: 1704-1753
Classification Level Classification E-value
Superfamily EGF/Laminin 1.3e-16
Family Merozoite surface protein 1 (MSP-1) 0.0042
Further Details:      
 
Domain Number 2 Region: 1659-1702
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000218
Family Merozoite surface protein 1 (MSP-1) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82596427|ref|XP_726257.1|
Sequence length 1772
Comment merozoite surface protein 1 precursor [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MKVIGLLFSFVFFAIKCKSETIEVYNDLIQKLEKLESLSVDGLELFQKSQVIINATQPTE
TIDPFTNHNFAQQVQDFVTKFEGLGFTEQTELVNLIKALTPNRYGVKYLIESKEEFNGLM
HAINFYYDVLRDKLNDMCANNYCEIPEHLKISEEETEMLKKVILGYRKPIENIQDDIEKL
EIYIERNKETVAALNALIAEETKKIQPEGNEDCNDASCDSDKYNKKKPIYQAMYNVIFYK
KQLAEIQKVVEVLEKRVSTLKKNDAIKPLWQQIEVLNAAPVVTAETQIVTGGQSSTEPGS
GGSSASGTSSSGQASAGTGVEQANTVASVTVTPSVGQNGEASTNPQTAQVQPVPTLTLEE
KQKKIAGLYAQIKEIAKTIKFNLEGIFVDPIELEYFKKEKKKESCNLSTSSCKKNKASET
IIPLTIRYPNGISYPLPENDVYNKIANNAAETTYGDLTHPDNTPLTGDLATNEQARKDLI
KAIKKKIKAEEKKLETLKTNYDNKLTEFNQQKTPFKEAAKEFYESKFRNKLTSEIFEKFK
TKRDEYMTKKTELNTCEYGNTKELINKLNKQLNYLQDYSLRKDIISNEIEYFSNKKKELQ
YNINRLAEAVQAKQNVLVASKDVPLSTLVELQIQKSLLTKQIEQLNKTEVSLNKAQLKDK
LYVPKTYGNEGKPEPYYLIAVKKEVDRLAQFIPKIESMIAKEKERMEQGPAITGESEEVP
SGPSAESSTDRSTQSSTSSSSSSSSTPAAAESSSATLPEAPAPAEAASPSTEASEETTIP
PTTQETQPSQAASSTTPAKPVMTKLYYLEKLQKFLVFSYSCHKYVLLQNSTINKDALSKY
ALTSEEDKIRTLKRCSELDVLLAIQNNMPTMYSLYESIVDGLQNIYTELYEKEMMYHIYK
LKDENPSIKSLLVKAGVIEPEPVAAPTPVTPAATEQQQQQATPDVQSDAPAPSDVSQQPE
TPVTSTTPEVTTSTEASSSAPGEGTPSGEAGASGTEGATASNAATPAGTSASGSAASNAS
TTSDVTPPAAAAAVPSTSTPAPAQPPAANSQSGNPDSGIRSRAESEEDMPADDFELDNLY
KSYLQQIDGNNTEFINFIKSKKELIKALTPEKVNQLYLEIAHLKELSEHYYDRYSTYKLK
LERLYNKHEQIQLTNRQIRDLSILKARLLKRKQTLNGVFYILNGYVNFFNKRREAEKQYV
DNALKNTDMLLKYYKARTKYFTSEAVPLKTLSKASLDRESNYLKIEKFRAYSRLELRLKK
NINLGKERISYVSGGLHHVFEEFKELIKDKDYTGKKNPDNAPEVTNAFEQYKELLPKGVT
VSTPAVAVTTTLAADAPATPEGAVPGAVPGAVPGAVPGAVPGAVPGSGTDTRVAGSSVDD
NEDDDIYQIASGQSEDAPEKDILSEFTNESLYVYTKRLGSTYKSLKKHMLREFSTIKEDM
TNGLNNKSQKRNDFLEVLSHELDLFKDLSTNKYVIRNPYQLLDNDKKDKQIVNLKYATKG
INEDIETTTDGIKFFNKMVELYNTQLAAVKEQIATIEAETNDTNKEEKKKYIPILEDLKG
LYETVIGQAEEYSEELQNRLDNYKNEKAEFEILTKNLEKYIQIDEKLDEFVEHAENNKHI
ASIALNNLNKSGLVGEGESKKILAKMLNMDGMDLLGVDPKHVCVDTRDIPKNAGCFRDDN
GTEEWRCLLGYKKGEGNTCVENNNPTCDINNGGCDPTASCQNAESTENSKKIICTCKEPT
PNAYYEGVFCSSSSFMGLSILLIITLIVFNIF
Download sequence
Identical sequences A0A077Y7Y3 P13828
73239.P13828 1871.m00018|PY05748|PY05748|merozoite gi|82596427|ref|XP_726257.1| XP_726257.1.76580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]