SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|82597089|ref|XP_726534.1| from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|82597089|ref|XP_726534.1|
Domain Number 1 Region: 67-107
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000644
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|82597089|ref|XP_726534.1|
Sequence length 132
Comment hypothetical protein [Plasmodium yoelii yoelii str. 17XNL]
Sequence
MVIIYQILKANLKIQIYLNPLKLELLQIHHSPNLQYNPGNTNGDSQNSIHSDDEEEDDED
EDDDEEDCSVNNGGCGENLLCEKMESGIIKCSCPSGYKLNGTSCIELLSAHSVNYCFCGI
LIILIILVSMIY
Download sequence
Identical sequences Q7RC17
73239.Q7RC17 XP_726534.1.76580 1971.m00036|PY05967|PY05967|MSP4/5-related|p_yoelii|chr_0|MALPY01971|1971 gi|82597089|ref|XP_726534.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]