SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|83753795|pdb|1Z3G|B from Protozoadb 2010_08

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|83753795|pdb|1Z3G|B
Domain Number 1 Region: 141-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000049
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|83753795|pdb|1Z3G|B
Sequence length 186
Comment Chain B, Crystal Structure Of Complex Between Pvs25 And Fab Fragment Of Malaria Transmission Blocking Antibody 2a8
Sequence
EAEASAVTVDTICKNGQLVQMSNHFKCMCNEGLVHLSENTCEEKNECKKETLGKACGEFG
QCIENPDPAQVNMYKCGCIEGYTLKEDTCVLDVCQYKNCGESGECIVEYLSEIQSAGCSC
AIGKVPNPEDEKKCTKTGETACQLKCNTDNEVCKNVEGVYKCQCMEGFTFDKEKNVCLGP
HHHHHH
Download sequence
Identical sequences gi|83753794|pdb|1Z3G|A gi|83753795|pdb|1Z3G|B 1z1y_A 1z1y_B 1z27_A 1z3g_A 1z3g_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]