SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|18977952|ref|NP_579309.1| from Pyrococcus furiosus DSM 3638

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|18977952|ref|NP_579309.1|
Domain Number 1 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.36e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00048
Further Details:      
 
Domain Number 2 Region: 32-112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000259
Family Eukaryotic type KH-domain (KH-domain type I) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|18977952|ref|NP_579309.1|
Sequence length 221
Comment RNA-processing protein [Pyrococcus furiosus DSM 3638]
Sequence
MGEDFEKLMKKFEKVSKDGEIIKEEEDEEWEEFFKQEEYVKIPKERIGVLIGKKGQTKRE
IEKRTKTKIEVDSETGEVWITSTKETTDPLAVWKARDIVLAIGRGFSPERAFRLLNEGEY
LEIINLTDIIIGNEKNALPRVRGRIIGRKGRTREIIEEMSGASISVYGKTVAIIGNPIQI
EIARTAIEKLARGSPHGTVYRYLERRKKDLELEGSMYYENL
Download sequence
Identical sequences I6U8F2 Q8U0K7
186497.PF1580 Pfu-1476753-001 gi|18977952|ref|NP_579309.1| gi|397652073|ref|YP_006492654.1| WP_011012726.1.13913 WP_011012726.1.59273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]