SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 529.m04171 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  529.m04171
Domain Number 1 Region: 59-153
Classification Level Classification E-value
Superfamily PH domain-like 0.00000451
Family Pleckstrin-homology domain (PH domain) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 529.m04171
Sequence length 200
Comment |TP04_0499|TP04_0499|hypothetical protein|Theileria parva|chr_4|c4m529|529
Sequence
MKRLDKYKLTSQLESNLARAYLLYKQADLLDEKAQEANKSLEILHSNDKDKVILRDCNML
KIGPLSYSNRGDNVIHKTKEPLMAKLTGNSLVLYHNKLPQLTYYMVDVEMPTKPVESASR
CLTFTYRGADQVFCSATEQSAHGWMNAITEAWFCKNLGIKGTLINLKKIESKKDEPISLL
KHAVKEDKNKAWLNQYGSLR
Download sequence
Identical sequences Q4N267
XP_764134.1.6148 529.m04171 gi|71028982|ref|XP_764134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]