SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 529.m04351 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  529.m04351
Domain Number 1 Region: 52-253
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-37
Family Nuclease 0.054
Further Details:      
 
Domain Number 2 Region: 241-418
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.85e-27
Family Nuclease 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 529.m04351
Sequence length 476
Comment |TP04_0329|TP04_0329|cardiolipin synthetase, putative|Theileria parva|chr_4|c4m529|529
Sequence
MFKFYNNKNNFNPNLDIDSFIYKIDSINSKNYPYLKHFSASEIYKWNGILTSLSSNFGKM
SSGNIVHIFQDGNETLTDMLKEINKAKESIFLEMYIFDDSPVAEIFANALKIASLRGCKI
VLLLDYIGSIRFSSKIQRELEELGVEIHFFNPLRLNNSIGPITYRNHKKLLIIDQKTAFC
GSLNICRNSVGEDLGGDGGYIDVSVKLNGPSVYDLCMSFLGSLKIANVHIDGLTISERAE
PIPGGSIVQIFESNTRKNKKDVLNSLLLVISKASNSIHLSTSYFIPPGSLRRSLISAKNR
NLNIRMLLSGNSDLPGDTSSTYYILKKFFRSRFAKPFRDNFRVFMTKNRHYHGKVMVVDD
IWSSIGSFNWDRLSSRRNMELTLGIFDPLVAHKLKQIQLENEKESYEYTRNDSLNRLKIL
KMYDCITYHIARFSEGNLVDGLSNERFNVVFKKTFIRTFVDQNVSEMFLTSNISSV
Download sequence
Identical sequences Q4N2L9
XP_763964.1.6148 gi|71028642|ref|XP_763964.1| 529.m04351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]