SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 529.m04499 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  529.m04499
Domain Number 1 Region: 201-338
Classification Level Classification E-value
Superfamily PH domain-like 6.46e-36
Family Ran-binding domain 0.0000615
Further Details:      
 
Weak hits

Sequence:  529.m04499
Domain Number - Region: 10-119,151-188
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000115
Family Apolipoprotein A-I 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 529.m04499
Sequence length 345
Comment |TP04_0179|TP04_0179|ran binding protein, putative|Theileria parva|chr_4|c4m529|529
Sequence
MAETLDSVVSSVTGTAEKVKKDMVDTFKSALEKSDKATENLAEKVKETFTLVSDKTKNFS
ENFTFDVSQSARKVADSVTESFDKMPEKVMDTLNFVSDGAQDFFGKMKHNVNELLETSTS
TTVDSGVKTDSTLTTTNNTTTTVDTNSVKVENKVDKLESLKSTVESVVESMKSGMEKALQ
PETSSKEPEYVEEEEVVEGDWKAPKVEVKEIKVETGEENEDVFWSQRSKLYRWATDTDGS
GVWKERGLGESKLLRHKETGKIRFLLRQEKTFKVVANHYVWQTNNMCKLTPNVGSDKIWV
WTAQNTLEDETKVEQLALKFPNVEQAKLFKEKFDEAAEVNSKLFN
Download sequence
Identical sequences Q4N308
529.m04499 XP_763814.1.6148 gi|71028342|ref|XP_763814.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]