SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 529.m04508 from Theileria parva

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  529.m04508
Domain Number 1 Region: 110-345
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.84e-50
Family RecA protein-like (ATPase-domain) 0.00000035
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.00000000000471
Family DNA repair protein Rad51, N-terminal domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 529.m04508
Sequence length 346
Comment |TP04_0170|TP04_0170|meiotic recombination protein DMC1, putative|Theileria parva|chr_4|c4m529|529
Sequence
MVTVPVTKSKGVSIQSSTNEDISDTILKPFQPIERLEELGINVTDINKLKAAGICTVLGV
IQTTKKDLCNIKGLTELKVDKISDCASKLEVTNSFISASELYKIRKSILKINTGSEMLNR
LLNGGIETMSITELFGENRTGKTQICHTISVTSQIINPTEPFKVCYIDTENTFRPEKIEK
ICERFDLDPMITLDNILYSKAYTNEHLLQLISNITSKMVEERFVLLIIDSIMSLFRVDYS
GRGELAERQQRLNKLLSNLLKIAQQFNVAIVLTNHVISEPSGALSFISNPIKPAGGNVIG
HASTCRLSLRKGKGNQRICKVYDSPNLPESECIFELSDSGIIDVTE
Download sequence
Identical sequences Q4N317
XP_763805.1.6148 529.m04508 gi|71028324|ref|XP_763805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]