SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|103533|fgenesh1_pg.scaffold_2891000001 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|103533|fgenesh1_pg.scaffold_2891000001
Domain Number 1 Region: 2-187
Classification Level Classification E-value
Superfamily PhoU-like 1.67e-57
Family PhoU-like 0.0000205
Further Details:      
 
Domain Number 2 Region: 532-608
Classification Level Classification E-value
Superfamily MetI-like 0.000000371
Family MetI-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|103533|fgenesh1_pg.scaffold_2891000001
Sequence length 610
Sequence
MHSLIHINAKEAAQIIQEDPELNRLEEKITELGSKLIATQQPVAKDLRRILVAFRISGDL
ERMGDLSVDIAKVVMRLDGQELIKPLIDLPRMAETVQTMIFESIQSYVQENVDLAYKMAK
DDDIVDALYSQIIREMFTIMVENPRTINQAMLLSFVGRYIERIADHATNIGESVTYLVTG
KRPDLNPVPLGRMIGRVRIDAEPCGDGIPGILGSDEAVMRMERPYLRLQQSRIGGMMDEI
GGIQQSDAELRLRLLQPEQQLVVEGGHDGAFQAIAAAEVVQQNFVEQRASGILDFNVDFD
PLDHSQVHAADRAGRASPRLALRQPRPCRRQRQQDLPLCLLGSACPLCRNGFHPVDDPVP
SDARHAQLPAGAARNRPGPVADRSVRSARFRLAHDDMDELRVSFRPAPGRHSRARQRCHG
QLADRRRFDVENVFLDQAAAAVADAVLPCGRLDHECLPIVRAGQHPDSGRPCRLYGCAGV
LHLPRSVRQLPVRHRQRARDRPVRPYAPADGGSIPRTWKEGALPVRGYGHSRHPVRLFSL
YGSLILLALFVLGPLLYLLAQSFMTPAEAGQYPPKLLPSGLYTGGLKNAIETVPIFGFIV
NSFVLAIAIM
Download sequence
Identical sequences A9U6U5
jgi|Phypa1_1|103533|fgenesh1_pg.scaffold_2891000001 XP_001786580.1.60028 3218.JGI103533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]