SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|141554|e_gw1.180.26.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|141554|e_gw1.180.26.1
Domain Number 1 Region: 448-745
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.85e-75
Family Protein kinases, catalytic subunit 0.00027
Further Details:      
 
Domain Number 2 Region: 61-190
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-23
Family alpha-D-mannose-specific plant lectins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|141554|e_gw1.180.26.1
Sequence length 799
Sequence
MTTRIVAQSASLDAQSFGLNATLGGNQTWLSENGTFTMGFYPIPANSSSLYLAVWYSGVP
VAPVWLMNRERAVKSGATLTLNNAGSLVLANADGSSVWTSNTSGVGVVGGKFLENGNIVL
RNSSNWTMWDSFDYPTDTFLPGLIVMGHKFTSWRTNSDPSPGLYTFEMLADGQLYFKWNG
TETYYNSGPWGGSYFTNPPQLGRTTSPDVFHFDNSTGSPRFYYNTSGRSATADISLKRMR
LDPDGVARQHIWVIDSNSWQTFISAPVEPCDSYHVCGKNSLCISSNYIPGCTCLPDFRPV
SAAEWSDQDYWLQGCGRDPALLGSCTTNASIANSTSDFSFMALAGATIEVNRTSPPQFFF
NDTESACRERCAGNCSCGSFSFSEVAPGTSTATNCDNNGSSFNGAKLIITVVIVCCVVVA
VAASLLWWLCIRRRDAKRRADAAAAFSVVGLARFTYKELVDATGNFGHQLGSGGFGTVFQ
GTLPDKSEVAVKTLNKLRQGEQEFRAEVAVIGTVQHINLVQLRGFCAEGDHRALVYEYIP
NGSLEKYLFRRVAGKGDGPQDVNNVMDWRTRMAVALGAARGIAYLHHECRSSIIHCDVKP
ENILLSGDFTPKVADFGLAKLMGKDVSRLITNIRGTRGYLAPEWLTNCTLTSKVDVYSYG
MTLLEIISGRRTVDLSYPADKWFYAVWAYKEISKGRDLTSLVDDRLAKGSVDAEELRRAL
HVGLWCTQDDPVKRPNMRDVEKMLEGVLDVNDAPAPPSYIAQTDEACNSGDSKIASTDEK
GSQLMNGISFEYTQTFSGR
Download sequence
Identical sequences A9T7Y0
XP_001774663.1.60028 jgi|Phypa1_1|141554|e_gw1.180.26.1 3218.JGI141554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]