SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|160077|estExt_fgenesh1_pg.C_180065 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|160077|estExt_fgenesh1_pg.C_180065
Domain Number 1 Region: 167-312,346-423
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.31e-53
Family PP-loop ATPase 0.00085
Further Details:      
 
Domain Number 2 Region: 403-506
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 3.14e-17
Family MesJ substrate recognition domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|160077|estExt_fgenesh1_pg.C_180065
Sequence length 521
Sequence
MGQAPLGHPHSGSWIDPAQEFQLPRTSIFSRIVVSKMSANFSRSECLAFQVHGFWSRVLY
QVFHSCHNPACCGASGMLIPTGLDSLSLAKASVRCVPLQLQFSQQLCIRRNVKVSFKESK
LFAAAKGGGEGPTDWSKLLDNPSPNITTTENVSEARIKHGFSQRLSKTIREHNLFRPGEK
ILVAVSGGQDSICLLHMLASLRDQWGWLLGVVYCDHRWSSSSRKQGSHISQVAASLRINY
YQAVTTSPVPSEGLARTWRYGILQRIALRHGFTSIVTAHTASDRVETLLYNLFRGSGLHG
LQSLTWRRVLSPLLSLSQRTAFAPTEIVSSLAAPNGEMVEVGSSEVALVRPLLGFTRTEV
REYCDLLGLPLWPDPSNMSLEIDRNRIRHQLLPYLRENFNDSVDKSLARCAEILHAEQQY
LDSICNNILKKAETEDADGRKLDIMIMQSLPVALQRRVLKQFVENFTGRSLGFDHVERLR
TAYSLSGDSRSASNGVSLALPGNASVKLLKSYFHLTRTKQI
Download sequence
Identical sequences A9RN39
3218.JGI160077 jgi|Phypa1_1|160077|estExt_fgenesh1_pg.C_180065 XP_001755591.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]