SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|165978|estExt_fgenesh1_pg.C_1000085 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|165978|estExt_fgenesh1_pg.C_1000085
Domain Number 1 Region: 93-176,213-240
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000000288
Family alpha-D-mannose-specific plant lectins 0.0097
Further Details:      
 
Domain Number 2 Region: 202-308
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.0000000226
Family alpha-D-mannose-specific plant lectins 0.0075
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|165978|estExt_fgenesh1_pg.C_1000085
Domain Number - Region: 387-418
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0863
Family Pan module (APPLE domain) 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|165978|estExt_fgenesh1_pg.C_1000085
Sequence length 439
Sequence
MKSSTGLHVGSKLVVITIFLLAAQCASQPNQEAPATRGVGYTASIDNRKNGVVPPLGPKL
LLRSSTGSHELWLQADPKNRCALSLRLAHTNSIYRLVWTANYFAVTPGGCDKCTVIFTKE
GDLQLHILYRGRTSMAWNTKTGGRNVKSMYLPNTGDLQLRNADKKVIFSSFGVREWAMLP
PQRLRVGEVLKSPDQDQEAVGADSTVQVLFNNGQYFLTLQKTGDLQLIMNGPKPQVYWSL
KKTLFKGNLKQVAYAAINKDGGLGLFTQNNQLVWGSPPPPKGFYASPYFGIDTYGNLKTY
YAFKNHAWFSSFKAFDNNCDLPNHCGDYSICSGADSKCSCPPQFTRTGIRSNAPYCKRNS
NVAKCSRKSFLELKGYDANINMYINPKRIGLTSCKASCLASCDCDGFYYDMATAFCHQTT
RFRTLRKVNNQKKLVYIKM
Download sequence
Identical sequences A9SP81
3218.JGI165978 jgi|Phypa1_1|165978|estExt_fgenesh1_pg.C_1000085 XP_001768194.1.60028 PP1S100_162V6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]