SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|168993|estExt_fgenesh1_pg.C_1960022 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|168993|estExt_fgenesh1_pg.C_1960022
Domain Number 1 Region: 207-268
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000011
Family alpha-D-mannose-specific plant lectins 0.0091
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|168993|estExt_fgenesh1_pg.C_1960022
Domain Number - Region: 281-382
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.000759
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|168993|estExt_fgenesh1_pg.C_1960022
Sequence length 719
Sequence
MAAEVADEVAAEMGAEGDWRGLELCRSAHFGLNLASSLLPPLSQRKLGRERKDGAGPAGF
GECWRRWFGLLRESCEHDQASFHRVSGWSRVGFKIHPLPHTSRLLFIHVFTCKSSCHNIA
SEYFGCGNLEWVHLISILLVWTILWGLIPSVRTAGLTSLGLSSRLSVGDTLVSPSGRFEL
GIFAPAGGSRADLGYQLAIRYAELQHVVTWVANRDIPLSSNAYVYVSPYGNLQLFDPINN
PNKPSWTSNAAANLGVVQALLLDSGNLVPEIRIRSFGWGGLNMSVLQLTWTSPKQFMTWT
GGAYIPAPDVHTPHTITGVSSVYFHPTFGHLYATSSPADTVLLSGSDPVAANTMKRITID
TDGGLRIWQWNIGTSKSWTAVANWVLVERPESRSQCTVMGTCGPYGWCISAKASVDKVQC
KCPNGFKPINEEDITRGCLPVVPLVGSDCNDTATVMMEELAGVDMPWGGGYQNLTGANSS
RCKEKCLSVCECAGRCPLFNIGYPTVELHGKDRTAFIKISKFQPLAPEPVKPFEHVRPAV
IGGIVGGLFVGALLTVTDIAEPSDRCAIGYLFLLKGILSRSCNSDFTTGDSVLFSRGPKS
SSDVVPNKLRMEMWMQRGSGRVQSYVRGPRFTLETVFKSRTYEHRLSALYLIPNYSRKFC
PGLCSCMDMLASFVLPIQVPMDVSRVERRLPCESQADDVTCARCQLPQSYTSIFIALST
Download sequence
Identical sequences A9TAV7
jgi|Phypa1_1|168993|estExt_fgenesh1_pg.C_1960022 3218.JGI168993 XP_001775763.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]