SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|176574|estExt_gwp_gw1.C_180009 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|176574|estExt_gwp_gw1.C_180009
Domain Number 1 Region: 351-636
Classification Level Classification E-value
Superfamily ARM repeat 1.15e-47
Family Armadillo repeat 0.0022
Further Details:      
 
Domain Number 2 Region: 241-320
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-30
Family U-box 0.00029
Further Details:      
 
Weak hits

Sequence:  jgi|Phypa1_1|176574|estExt_gwp_gw1.C_180009
Domain Number - Region: 121-188
Classification Level Classification E-value
Superfamily PhoU-like 0.075
Family PhoU-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|176574|estExt_gwp_gw1.C_180009
Sequence length 656
Sequence
MTTMSPPSAILSSQALANSLVVLAQQVANCGRSQVCQKRNAANLSRRIKLLSPLFEEVRD
MNPPMPPSALISFREIYHVMMKTKEMIEACGEASVFLSIFRNKSTSEKFEKLTGSLADAL
EILPLDLLDISDEVREQVELVKMQVQRAKLFVDSLEDALAEEVIELLARVEREEEPDTRQ
LQSLFANLGLKNARECEKELQKMETQSECVLYGVTEMEDSNWSQESSVEDSCEFSSSGRV
DVIANPPDEFRCPISLDLMRDPVIVASGQTYDRVSISKWIEENHTTCPKSGQKLGHLNLI
PNYALRSLITQWCEDNHVPFDKPEKSSKGGAGNNQVASSKAALEATKMTASFLVGKLATG
SPEVQKQVAYELRLLAKCGADNRMCIADAGAIPYLVTLLSSKDPKTQKNAVTALLNLSIY
DKNKSLIINAGALDPIIAVLRFGGSMESRENAAATLFSLSVVDEYKIVIGKRPDAISGLV
TLLRDGTPRRGKKDAASALFNLAVYHGNKSPIVNSGAVAVLVSLLSEDEAGVADDALMVL
GLVAGSTEGLTAIAEANAIPILVRLLRVGTPKGRENAIAVLLVLCRSGGEKMVTAAIECS
TAVSSLCSLLTMGTPRAKRKASSLLKLIHKREPEHHNPPSANFISNAHFGQLATRQ
Download sequence
Identical sequences A9RMY9
XP_001755474.1.60028 jgi|Phypa1_1|176574|estExt_gwp_gw1.C_180009 3218.JGI176574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]