SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|64045|fgenesh1_pg.scaffold_1000419 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Phypa1_1|64045|fgenesh1_pg.scaffold_1000419
Domain Number - Region: 180-230
Classification Level Classification E-value
Superfamily XRCC4, N-terminal domain 0.000248
Family XRCC4, N-terminal domain 0.0047
Further Details:      
 
Domain Number - Region: 274-312
Classification Level Classification E-value
Superfamily PhoU-like 0.0129
Family PhoU-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|64045|fgenesh1_pg.scaffold_1000419
Sequence length 858
Sequence
MMNLSSTSSRSFKGSNERDTAEENKFYKKTKCRKRWTVNLGNLKKYKPRGRLYQEGRAGE
EKSNIFEEQECEARAVPCVISTPAKRGVVKICAQVGLYDALELCVFELMAMMRVEIAEEA
LAIFSSPESRPPSHVLISFVAVHTETSGEMARVGNLTCVRFDNVVRHGGIHNAPHLFVKG
TWLPSAFSISVHDGSLAWTGKADKDFILNHAGKLGMTESEYVDTMQCYFSEQQPDATYEL
RRTTNSSAELRCYKESSPELVLRFPMSTNSDQTVAIDMVQLLLDAYHQVDEVLAKKIRAH
DREIAAKELALASLKNQLEERGKSAAPNGYTNGQPNDEEEGAGGLILFGEASSRGKRKSG
GSNVETSSRKRMSTLVKTSDALPLYQKPGSPEASGDDDLLEKQSSPSAVRPPLSALGYKQ
PAAAEERHTSFKGLFDEIGAEANKERSNVAFKPTLSDETQTTPKKPFLDHFSDATTVLVS
KDNLDPASVSGRKGGGKYQGRSGGRAGGKVSKKYPPPPSVENSVEDQVEDVVEKSIKCVD
NIVSTPLSTAVKPRGAAPTSAKKSTASKSSSKAKKSGPKSGKRKSKPVVAMEETSLEVSE
KVDASEEAEVNAKPEDEDTDRIIAVQSAEFHDFDQTRTESDFKAGDFWALYDDQDSMPRF
YARVLEIITDGSFQVQVQWLEPYKPSLPANGLVKTAHLSASCGEFTLGTLGHENALQNLG
AFSHKIKVGEEAKKMVKYFPRTDEIWALYRHWDKKQVKKDDQDELKYSYDLVQVKSTPSP
AEGVDVVPLAKVAGFKSLFTVADAGKFTISYKQLQARFSHCIPAIKLSCAESPGTPVGSF
ELDPASTPTEYLGIGDSS
Download sequence
Identical sequences A9RBW3
XP_001751634.1.60028 jgi|Phypa1_1|64045|fgenesh1_pg.scaffold_1000419 3218.JGI64045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]