SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|116893|e_gw1.18.17.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|116893|e_gw1.18.17.1
Domain Number 1 Region: 161-333
Classification Level Classification E-value
Superfamily Bet v1-like 4.53e-38
Family STAR domain 0.0061
Further Details:      
 
Domain Number 2 Region: 1-110
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000504
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|116893|e_gw1.18.17.1
Sequence length 731
Sequence
MEGWLYLIGSNRLMMTNPRKRYVVLCGNQARFYKDKPAHREEVAAPIKSGTVDPYKRVAD
HGRENILGRTLFVFTVYDSYIHEDKLKFGARSSEEAAKWMEAFKEAAEQVSFAEYFINLL
VRIHEDSTTLAGCTRTLTAIRFDAHMFVSLLPKDASPDVVADSPWQIFGCENGLRLFKEA
TDHHGLKSMVRHDPPALMSVGVVHATCESVFETVMALGSSRAEWDFCYLKGRVIEHIDGH
SDIVHKHFHKFWLSSRMKPRDLVVHRYWRREDDGSYVILYTSVNHEKCPPRRKFVRAWLK
SGGYVISPLPTQGGYPNRCMVKHILTVDWKNWKSCWSPCRDKDITLKVLERVAALKEFYK
IKPSDYMPSSMGPNVRQPARCKLPVAQKENILPIHLNDDAAAFLLEEKNVGKSMFQQLAE
DEFFDVPEDSAWDLELDRDLDGQQQNTDLEETSDEDKVRQSGFGFDRLIALDMPFAAQKR
TYQDTDQDDIDLLTREGTLPKISSSGTTSCYQSAEASTFLIRGKHYLQDRKKVVAKDPVM
QFVAADWLKSNKREDHLANRPSYPVQLFLANQGRVDDAFFFIINIQVPGSTTYSLALYYM
ITQPLSDFPLLENFVHGDDRYRNAGFKLIPHIAKGSWIVKQSVGKTACLIGEALEITYHS
GKNYIELDVDIGSSSVAKGVVNLVLGYLSTLVIELAFLIQANTEEELPEYLLGTCRLVNL
DIAKAIPARPE
Download sequence
Identical sequences A9RND1
jgi|Phypa1_1|116893|e_gw1.18.17.1 XP_001755631.1.60028 3218.JGI116893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]