SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|127779|e_gw1.67.32.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|127779|e_gw1.67.32.1
Domain Number 1 Region: 159-328
Classification Level Classification E-value
Superfamily Bet v1-like 5.63e-39
Family STAR domain 0.0069
Further Details:      
 
Domain Number 2 Region: 1-118
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000011
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|127779|e_gw1.67.32.1
Sequence length 707
Sequence
MEGWLYLIESNRLMMTNPRKRYFVLAGNRAFFYKEKPAHPDETPIKTGIIDPSTRVADHG
REKIHGWTLFVFEIYDSYNHDDKLKFGARSSEEAARWMSALKEAAEQHKRPIPNFYVTEL
GISQLCFINRKRRVRVTFIDSGTCSVNLVNMMDASPDVIADSPWQIFGCRNGLRLFRETT
DHHGLKSMDPPALMAVGVVQASCESVFESVMSLGSSRVEWDFCYSKGRVIEHIDGHSDIV
HKQLHKYWLPWRMKPRDLLVHRYWRREDDGSYVILYKSVNHERCPPRRKFVRAWIKSGGY
VISPLPPQGGFPYRCAVKHILTVDWKHFNMRWSHCRNRDITLRVLERVSALSEFYKVKPA
DYMPISIGQDLRRLNLTGCKFQVSQKQNISSVHLTDDEVSHSQGNNTAGQSMFRQLAEDE
FFDVPEDSAWDTELEPDLDGQRKSADPEETSDEVQRMHQDTVEDGIELMVRAGTLPKSSC
SCTTSCYESAEASVFLVRGKHYLHDRKKVVAEDPVMQFVAADWLKSNKREDHLASRPSHP
IQKFLANQGRVPDPFFFIVNIQVPGSTTYSLALYYMITSPLSDFPILENFVSGDDRHRNA
SFKLIPHIAKGPWIVKQSVGKTACLIGQALEITYHIDKTYIELDVDIGSSSVAKGVVNLV
LSYLSNLVIELAFLIQANTEEELPECLLGTCRLMNLDIAKAIPALLE
Download sequence
Identical sequences A9SDD6
XP_001764317.1.60028 jgi|Phypa1_1|127779|e_gw1.67.32.1 3218.JGI127779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]