SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|144666|e_gw1.218.19.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|144666|e_gw1.218.19.1
Domain Number 1 Region: 188-461
Classification Level Classification E-value
Superfamily Mitochondrial carrier 8.63e-77
Family Mitochondrial carrier 0.0000367
Further Details:      
 
Domain Number 2 Region: 15-184
Classification Level Classification E-value
Superfamily EF-hand 5.33e-33
Family Calmodulin-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|144666|e_gw1.218.19.1
Sequence length 470
Sequence
MKKAAKSRGFDLESEEERELRVRKLFNSLDSRKCGYLESKQIESGLQSLSFPFQRKYALE
LLEACDSNHDGHIDFAEFQRYMNDKEVELFKLFQAIDVSHDGALQPEELQLALRNSGVQL
EDHELDAFVQYIDRDKNGKITFNEWRDFLLLYPRETTLPNIYQYWEKICLVDIGEQAVIP
EGIGEHHRLRYLAAGAMAGAVSRTATAPLDRLKVLLAIQTHSSTSSIMNGLVQIHKHNGA
IGFFRGNALNVFKVAPESAIKFYAYEIMKRVVVGDGKDGEIGTLGRLVSGGTAGAIAQTI
IYPVDLLKTRLQCHNEPGRAPQLVKFTRDILVQEGPRAFYRGLLPSLLGIIPYAGIDLAT
YETLKLKSRHLLPPETEPGPILHLCCGTFSGALGATCVYPLQLIRTRLQAQTLKSAVRYT
GMADAFRRTYRNEGIRGFYKGWLPNMLKAVPSASITYLVYEDMKIRLSIK
Download sequence
Identical sequences A9TF81
3218.JGI144666 XP_001777279.1.60028 jgi|Phypa1_1|144666|e_gw1.218.19.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]