SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|151722|e_gw1.343.9.1 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|151722|e_gw1.343.9.1
Domain Number 1 Region: 174-365
Classification Level Classification E-value
Superfamily Bet v1-like 1.28e-41
Family STAR domain 0.0032
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000939
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|151722|e_gw1.343.9.1
Sequence length 729
Sequence
MRMEGWVYILNPSKLRLNHPRKRYLVLVGNRASAFKDKSRAKDESPLRSGIIDLGTRVTD
HGREIVLGRVFFVFSVHDPHASEAKLKFGVQNAEDAARWMQAFRNAAERVRNFSSNWVFF
QVSCRHSHLVSIKLSFQLQDENAVQTLGEAIRNLKMPNWTGALLAKDASPDVVASSPWEI
FGCKNGTQISSLDLAMIRGGTPPALMAVGVVDAIPATVFDTVMALGPSRAEWDFCFHQGQ
IIDHVHGHMDIVHKQFHSKWLPWRMKPRDLVFERYWRRDDDGTYVILYRSIKHPKCPPSK
KFTRAYVLSGGYVISPLTGKNAEVNRSMVKHIMKVDWRGYFWRKSRNRNMSLLMLERIAA
IRELFKVKERPPVPLKTERRENEESIFERAQSQQEFANTLSNKLTNQSTLEESESKFLQV
ADDEFFDAEEPLSWKRESQSELMSSDEVEGSSMDEEQYEPRNYIASFQFTCSNEKQYSSF
ASQGGTRDRTTEGDLEFMKRESSLGTMTWDTAESSTFLIRGKHYLRDHKKVKAGTPVMQL
VAADWFKSDRSEEHLAARAGCVIQKLFTSAQRVAESYFVIINLQVPGTPSYSLVLYYMAN
KLLQDIPLLEGFVRGDDHYRNSRFKLCPHVAKGSWIVKQSVGKSACLVGEALDINYFSSD
NYLEMDIDIGSSSVAKGVVNLVANYASKLVLEMAFLIQANTDEELPEKLLGTVRISNLDM
AKAVIPPAP
Download sequence
Identical sequences A9TW70
XP_001782866.1.60028 3218.JGI151722 jgi|Phypa1_1|151722|e_gw1.343.9.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]