SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|167975|estExt_fgenesh1_pg.C_1620079 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|167975|estExt_fgenesh1_pg.C_1620079
Domain Number 1 Region: 112-187,214-219
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00000000249
Family alpha-D-mannose-specific plant lectins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|167975|estExt_fgenesh1_pg.C_1620079
Sequence length 551
Sequence
MGFKDPLVLLLLSCMFLGRTLEVRAQGTTTPTSPVLPGSSSAYGEWSVVESPEERIRKKT
ILVNGTFSFNLMITSHSRFPCVAAVQHSPSNLTVWVANFNGSFDGSTDGVGGNLNNQPLV
CILRFSEKGGLVLTASDREIWSNSKDVLSKGYFSDLQLDSRGCLSISNRYVEEKDAIVWK
SFDYPTDTLVSGQKLTVNSWMTAAQLDREYSSGDIFYMQVTPETVVLAHDFKINGTRRVP
YRTFPSLPQHSSNGESIQYIAMWNGLDAYGENDNKLFLLSNGSIANLDNAQWDYARLGSD
GGLRLKKYNSADTKLLYPESDDSCSLPGKCGSYGICTGNGKCSCPEGFDIITGSFSCQRA
HALPANDINGCSGDRLVKVTGQTFLDILNDTTASDLKEWECEIRCKNSCNCTMALHVRRN
ATTDLGACFVNLDDAVQTIHQTGSKDDLQTLFLRISTTGLNPGFVPSPGSGTGSGGRPDA
KSSRRSVAIAFAGVFGALVFLLFVGSAWWLYYLRKKLFEEAGREEFDLIPPQLGPPQFTY
KQLVESPSNFA
Download sequence
Identical sequences A9T497
3218.JGI167975 PP1S162_138V6.1 jgi|Phypa1_1|167975|estExt_fgenesh1_pg.C_1620079 XP_001773395.1.60028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]