SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|196926|estExt_gwp_gw1.C_2790008 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|196926|estExt_gwp_gw1.C_2790008
Domain Number 1 Region: 196-365
Classification Level Classification E-value
Superfamily Bet v1-like 2.47e-29
Family STAR domain 0.01
Further Details:      
 
Domain Number 2 Region: 12-121
Classification Level Classification E-value
Superfamily PH domain-like 0.00000229
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|196926|estExt_gwp_gw1.C_2790008
Sequence length 743
Sequence
MGSGRQSDGREVPNYAGWVFHVGTSSLGYQFCRPRYLVIKGKNVTMYKTDPGDNPRSIPM
RSGLVGTHLMVEEVGRRVFHSGPLYVLKIYSKLDDSRNGEFACTNCEEVEKWISAFRHAK
EEVSVLFRNLSGGSVLIDSDNMFDINGPRKGSRGIANIGRLITIGKAGPEALLRRPSMVA
QDPESDGFYNYPQGDTFELADWRCVYIVNGLRIFEDATASKAEKGHIMKSVGVIDAAAET
IFEHIMSFNTKMRYQWDMYMGNLELVEEIDGHTDIVYGSFDPKFFKRFQKKTDFLFSRVW
RRDQDGSYSITQIFTTHKKCPPKRGFNRINISPGIWEIMPLPPKPGFGSPRCLVTQMIEV
KSTGWGRWKHSSFSKFLTTIPYILLCRTAGLRELVAANPDNTHLETQVKTKEVKKSVDEQ
GLSGLNSLLTRPPDSLHAEPQEEFYDALMVEYPDEDEDDAARSMLSKQRTASQKFKGISW
GVVVGLSKSKKAPATRAEKELDWNFPAVHFEDGVFQSGLRRCDGRSDHGWSDPGGKGFMV
RSVTYNNDGLKTTGGDPLLKLLAVDWLKSDKRIDNVAKRPSCCVQSDAGKKAPFILIINL
QVPASPNYSLVMYFVSERPIRQGSLLDRFANGDNAFRNSRFKLIPSIVEGYWVVKRAVGT
KACLLGKAVTCNYFREDNFLEIDVDIGSSSVARNVVGLVLGYVTSIVVDLAVLIEATNSE
ELPEYILGTTRINRFTLESAVQV
Download sequence
Identical sequences A9TP96
3218.JGI196926 XP_001780427.1.60028 jgi|Phypa1_1|196926|estExt_gwp_gw1.C_2790008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]