SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|215235|estExt_Genewise1.C_1130030 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|215235|estExt_Genewise1.C_1130030
Domain Number 1 Region: 167-442
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.14e-79
Family Mitochondrial carrier 0.0000444
Further Details:      
 
Domain Number 2 Region: 2-167
Classification Level Classification E-value
Superfamily EF-hand 6.04e-31
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|215235|estExt_Genewise1.C_1130030
Sequence length 451
Sequence
MRIRKLFEAFDSGKCGYLESTQIESGLQSLSFPFQRKYVLELLEACDANRDGRIDFAEFR
RYVNDKEIELFNLFEAIDVSRDGVLQREELLFALRNAGVQLGDQELDAFLQHIDQDKNGH
ITFGEWRDFLLMYPHEATLSNIYQYWEKISLVDIGEQAVIPEGIDEHNRMRFLLAGAVAG
AMSRTATAPLDRLKVMLAVQTHSTTSSIMHGLTHIYQKNGVIGFFRGNGLNVLKVAPESA
IKFYAYEIMKSALVGDEKHGEIGTLGRLVAGGSAGAIAQTIIYPLDLLKTRLQCHNEPGR
APRLAKFTYDILIHEGPRALYRGLLPSLLGIIPYAGIDLTTYETLKIKARLLLPPGTEPG
PFVHLCCGTFSGAFGATCVYPLQLIRTRLQAQSSKSNERYTGMVDAFRHTYRKEGLRGFY
KGWLPNMLKVVPSASITYLVYEDMKTRLSIK
Download sequence
Identical sequences A9SSH1
jgi|Phypa1_1|215235|estExt_Genewise1.C_1130030 XP_001769325.1.60028 3218.JGI215235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]