SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|223885|estExt_Genewise1.C_2710039 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|223885|estExt_Genewise1.C_2710039
Domain Number 1 Region: 2-484
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.96e-151
Family Calponin-homology domain, CH-domain 0.00000000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|223885|estExt_Genewise1.C_2710039
Sequence length 526
Sequence
MYLEKDPVLQRVLPIDPSTNQLFDIIKDGILLCKLINVAVAGTIDERAINMKEKLNPWER
IENHTLCLNSAKAIGCSVVNIGTQDLGDGRPHLVLGLISQIVKIQLLATVNLKQTPELAE
LLDETEEFDELWSMPAEKILLRWMNFHLKKAGHKKTVSNFTTDVKDATAYCLLLNQLAPE
SCSLDPLHIEDVYERSKAVLAQAERINCRKYITPKDLVEGSANLNLAFVAHLFHTKNGLT
QDTSKYDYAELLQDDEYKEASREERMYRTWINSQGTETFVSSLFEDVRDGWVLLEALDKV
APGSVNWKSATRPPIKWPFKKVENCNQVVDIGKRLKFSLVNIAGLDIVQGQRKLILAYLW
QLMRFSMLQLLKDLKLHGREVSDADIIHWANLKVRNVGKTSRMENFKDKSLSTGLFFLDL
LGAVEPRVVNWTLVTRGVTDEEKRVNATYIISIARKLGCSVFLLWDDIVEVRPKMILTLT
ASIMLWNLANKASKESETSASLGKWAAAVSKIDATNKFGNSLRTSV
Download sequence
Identical sequences A9TNA2
3218.JGI223885 XP_001780076.1.60028 jgi|Phypa1_1|223885|estExt_Genewise1.C_2710039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]