SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Phypa1_1|94057|fgenesh1_pg.scaffold_253000022 from Physcomitrella patens

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Phypa1_1|94057|fgenesh1_pg.scaffold_253000022
Domain Number 1 Region: 181-322
Classification Level Classification E-value
Superfamily Bet v1-like 5.77e-39
Family STAR domain 0.0039
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000548
Family Phosphotyrosine-binding domain (PTB) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Phypa1_1|94057|fgenesh1_pg.scaffold_253000022
Sequence length 623
Sequence
MTGPTMEGWMVRYGRRKIGRSYFHKRYFVLESLILAYYKRQPSANEVPIKTLPIDGNCRV
EDRGLETHHGHTVYVLSVINKKEPSHRITMAAFNVQDASAWKEALEQVIDQIDPDRDASS
SDHDSQFLSRPSFSLGPPESIEDWSRGIDPRWKDTGTLSVVRMASLRLVTCDTFLCRSYV
SSGTCGMKAVGVVEASCADIFELIMGIDETRYEWDCSFHEARLVQEVDGHTTILYQRLQL
DFLPMFLWPRDLCYLRYWRRNDDGSYVILFRSKEHPSCPPEPGCVRAHIESGGFTISPLK
SHPNGDPRARVQQLVHIDLKGWGANYLPLCHYHSVIQILNSVAGLREWFAQRDGNCQSNY
DESEYDDDDMQFYADSEVKSVSEPPPVSLDLSMLSGNLGKGDLDNGKNCWSIPDCNNFRV
RSKHFLIDRSKASEPLMQLVAVDWFKDIKRIDHVAKRKGCVAQVAGEMGLFTVAFNVQVP
AASHYSMIFYFVAPKAPQGSLLQRFVDGDDNFRNSRLKLIPSVPQGSWIVRQSVGTTPCI
LGKAVDCTYYRGSNYLEVDIDIGSSTVANGVLGLVFGVVSALVVDMAFLIQGNGMEELPE
RLIGAVRVSRLSLASATTPPEAD
Download sequence
Identical sequences A9TKT1
3218.JGI94057 XP_001779209.1.60028 jgi|Phypa1_1|94057|fgenesh1_pg.scaffold_253000022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]