SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2.m00102|PY00003|PY00003|hypothetical from Plasmodium yoelii ssp. yoelii 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2.m00102|PY00003|PY00003|hypothetical
Domain Number 1 Region: 366-463
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 4.25e-16
Family Cdc48 domain 2-like 0.0022
Further Details:      
 
Domain Number 2 Region: 581-626
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000106
Family RING finger domain, C3HC4 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2.m00102|PY00003|PY00003|hypothetical
Sequence length 628
Comment protein|p_yoelii|chr_0|MALPY00002|2
Sequence
MERKSGKSKYMHFLPIINSQRKLNILEKNNVLEKIHILPIKKKSSNYHELYNKLNKLINE
KSILYEGIVISLKDGSEHSDLKLSKIPHINEKEESIKIKNKINNDDVFGIDKISTDESSS
DENQTCDVDLPLNDNNNDNXDNNDDNDDNDNNDDNDNNDENEKMSELIVNNVDYVIINCI
PSKGVLNHDTLIYTDGKYVDYLKKIEIIIINDKHYKKYEKNIKRKFISFKKMLLKKSNDF
FNGAMSLFPLYFNFIPELCMSKNRNKVSKNEQCSIERIPNLGTCDECDTNKTNKTNRTNQ
INNIITQKFLTTHLIPYFKNNRNKLFYPGKLFNVNNFSFLVSKIDVDISAGFIDDLTEIN
LRFDSYEEYTHVHIVPLYDTLPTTYNYNLFIDYIKPYIERHYLNTFSIYDTFFYRGVQFK
IMGVEPINMKCGKGRISANTSIYIQGSVKPTFFDVISNKSFNYIKSLPFEYKPYAILNIL
QHLDTDSLLRLFPSANINMESSTKNEQTILHSLAPLMYIYNKENISYASNRGDSSRSDSS
RIDSNGGNSSRSDSNGGNSKDVIIEQSNGHSELNNNIINEQCVVCFEHFINDDKCIKLTC
LHTYHWKCVQNWFRFNLTCPCCRHKLNI
Download sequence
Identical sequences Q7RTI8
2.m00102|PY00003|PY00003|hypothetical gi|82704534|ref|XP_726594.1| XP_726594.1.76580 73239.Q7RTI8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]