SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2177.m00021|PY06415|PY06415|merozoite from Plasmodium yoelii ssp. yoelii 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2177.m00021|PY06415|PY06415|merozoite
Domain Number 1 Region: 310-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000186
Family Merozoite surface protein 1 (MSP-1) 0.016
Further Details:      
 
Domain Number 2 Region: 263-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000708
Family EGF-type module 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 2177.m00021|PY06415|PY06415|merozoite
Sequence length 371
Comment surface protein precursor|p_yoelii|chr_0|MALPY02177|2177
Sequence
VLIRKERKRKSKSDFSKGEPENKEHEIINLYDDVQELLGPDEMNMLDKYSILGIDDCSNE
NENNKIISEYDLKAMKSVLLYKNRISRASINNLDDVKTVFKRCFNKDDPELSKSYEQIQN
QVANEGTTIIDYLSNYISNIYIKINDEFVKNEEFQLSKYIPELEIINYVLYNGPKEIGNK
IKNELIEINNLIISESLTSIYSSVVSGLNINCKIKDDLITILNLANGKYFKVNFSSQATM
IIPEQYSHESEHMKKISEYFIEKNRVCKNENCPINSNCYVIDSVETCRCIPGFSKNEESE
NLECLINESTSCENNNGGCDVNANCILLEDKIMCECNNKFNGDGIYCSSAIYYGMNVFIF
FLISIVCIYIM
Download sequence
Identical sequences Q7RAT4
XP_727065.1.76580 gi|82705673|ref|XP_727065.1| 2177.m00021|PY06415|PY06415|merozoite 73239.Q7RAT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]