SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 2426.m00031|PY06901|PY06901|cardiolipin from Plasmodium yoelii ssp. yoelii 1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2426.m00031|PY06901|PY06901|cardiolipin
Domain Number 1 Region: 62-201,251-309
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 7.06e-33
Family Nuclease 0.023
Further Details:      
 
Domain Number 2 Region: 331-395,476-532
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 6.44e-16
Family Nuclease 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 2426.m00031|PY06901|PY06901|cardiolipin
Sequence length 605
Comment synthetase|p_yoelii|chr_0|MALPY02426|2426
Sequence
MKVENKLREKIYKHILNKKGEEWKEDGIDFTKLVDSNVEKLNLNENDKILIKRKWVNILK
RNAEKYGKVSEGNKIKIYNTGYACFKNIIKSIDRCKKRVWFESYIFDDSNFAEQIINSLC
NASKRGCDVILLVDYIGSLKLKNKWVNKLKENNVNVIFFNTFLNSFLNILPIFFRDHRKI
IILDDSAYCGSMNVSENVIPNFLNIVKNDKNERLLNIEKGCQNYNLLNKKESDNIEEDIF
INDMLGKKNNCLEYYDLHVKLKGPAVKDLADVFLDSLKMSNANIIREPIENQKKYKKSDG
DNSGCYIQVLESNVLRKIKSIQSSFEYIIKNGATNNIYITTSYFLPPGFLRRALFYALSN
GVNISFLFSGNSDILGDVPATYYIIKKFLRKYGHAKDKMVCDNISNNDDDDDKILNFENR
LINNYHNVLYSKKDKLLKWKKIYFKDLKKHVEYKFGDNLLLRKKHKGISEFYFFEKKHCH
AKNIVIDNLWCSIGSFNWDRFSSRRNLEVMISIFDKNISDQFIKEHEEKKKNSSKQITLS
NINNRNVFQIFFSYCAYHIGKLYGKNIFDGLSNNNKKTILRKAIINRYLADNCIDHISLN
MMWGT
Download sequence
Identical sequences A0A078K2Z5 Q7R9G1
73239.Q7R9G1 XP_727656.1.76580 2426.m00031|PY06901|PY06901|cardiolipin gi|82753384|ref|XP_727656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]